DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG34447

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:324 Identity:97/324 - (29%)
Similarity:150/324 - (46%) Gaps:30/324 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGLKNSKADLTTAKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVESI 77
            |.:...:.......|.||...|..:..:.|..|    |...:....:...:.:|||..|.|....
  Fly    30 CQVVRGECPNKNISFWLYSNSTRENPILLDPLD----LNPWNFQPPRPLKILIHGYTGDRDFAPN 90

  Fly    78 HVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDHGLDI-EKFHIVG 141
            ..|....|:.:|..:|.:|:|.|........|..||..:...||:::..:.|..:.. ::.|::|
  Fly    91 SYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIG 155

  Fly   142 HSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPG---THLSANDAEFVDVIHTDAWLY 203
            .|:|||:||.....:.      ||:|||:.||||.|||..|   ..|...||:||||||||.:..
  Fly   156 FSLGGQVAGQTANYVK------RKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGR 214

  Fly   204 GAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKK 268
            |...:.|..||:||.| :.||||.:.|   :.|....:|.|:..|:|||::.  .:||.|.....
  Fly   215 GYLRAAGHVDFYPNFG-AKQPGCMEEN---MQDPSSCNHERAPRFYAESINT--TVGFWARQCSG 273

  Fly   269 WSDFKQNKIVENCP----PVVMGHHCPTTIHGDFYLQTNGHTPFARGKEGTVYVDPKDLLGNTH 328
            |    ..:::..||    ..::|:|....:.|.::|||...:|:|.||...  ||.:..|...|
  Fly   274 W----LLQLLTLCPTTGAQALLGYHVSDELRGSYFLQTASKSPYALGKMQD--VDNRQTLAKFH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 87/287 (30%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 88/287 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.