DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and pnliprp2

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:366 Identity:109/366 - (29%)
Similarity:166/366 - (45%) Gaps:70/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLLCGLKNSKADLTTAKFILYYGPTVADSDIYDLTDFQSL----LEDEHLDLGKNTVLYLHGYLE 70
            |.:..|.:|...:.| :|:|:   |..:.|.:.  :.::|    :...:....:.|...:||::|
 Frog    40 RPIARLPDSPEHINT-RFLLF---TKENPDTFQ--EIRALTPGAISTSNFKASRKTRFIIHGFIE 98

  Fly    71 DP-DVESIHVIAEAYLERKDTNLIVLDWGELADGNYMF--DAFPNLKQLGPELAKVLLKMFD-HG 131
            .. |....|:.| ..|:.:|.|...:||   ..|.|..  .|..|::.:|.|:|..:..:.: :|
 Frog    99 HGYDRWLTHMCA-TLLKVEDVNCFCVDW---TGGAYALYSQAANNVRVVGAEVAHFIQFLSNQYG 159

  Fly   132 LDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY---PGTHLSANDAEFV 193
            ......|::|||:|...||    |..|||.|   |.||:.||||.|.|.   |...|..:||:.|
 Frog   160 YSAANVHVIGHSLGSHAAG----ETGKRTPG---IARITGLDPAGPFFQNTPPEVRLDQSDAQLV 217

  Fly   194 DVIHTDAWL------YGAPTSTGTADFWPNGGYSLQPGCPKR-------NYKMLSDND---LSSH 242
            |||||||..      :|...|.|..||:||||.:: |||.|.       ||::...:.   ..||
 Frog   218 DVIHTDASAIFPLTGFGIGQSVGHLDFYPNGGKNM-PGCKKSPTLKYLDNYRIFKGSKEIIFCSH 281

  Fly   243 RRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVE----NCPPVVMGHHC-----PTTIHGDF 298
            .||:.|:.||:..  |..|.|.|:..:..||:.....    .||  :|||:.     ||:.:..|
 Frog   282 IRSYKFYTESILT--PDAFVAFPSSDYKTFKKGTGFPCPSGGCP--LMGHYAEEFLGPTSGNLSF 342

  Fly   299 YLQTNGHTPFAR------------GKEGTVYVDPKDLLGNT 327
            :|.|....||||            |..|::.|....:.||:
 Frog   343 FLNTGNSEPFARWRYRVTVRTTGTGFLGSIQVSLHGIRGNS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 96/315 (30%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 100/333 (30%)
PLAT 355..466 CDD:320707 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.