DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and PNLIP

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:363 Identity:105/363 - (28%)
Similarity:155/363 - (42%) Gaps:84/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKADLTTAKFILY-------YGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVE 75
            |..|:.| :|:||       :....|||.....::|::         .:.|...:||:::..:..
Human    47 SPKDVNT-RFLLYTNENPNNFQEVAADSSSISGSNFKT---------NRKTRFIIHGFIDKGEEN 101

  Fly    76 SIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELA---KVLLKMFDHGLDIEKF 137
            .:..:.:...:.:..|.|.:||...:...|. .|..|::.:|.|:|   :.|...|  |......
Human   102 WLANVCKNLFKVESVNCICVDWKGGSRTGYT-QASQNIRIVGAEVAYFVEFLQSAF--GYSPSNV 163

  Fly   138 HIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT----HLSANDAEFVDVIHT 198
            |::|||:|...||..||    ||.|.  |.||:.||||.|.| .||    .|..:||:|||||||
Human   164 HVIGHSLGAHAAGEAGR----RTNGT--IGRITGLDPAEPCF-QGTPELVRLDPSDAKFVDVIHT 221

  Fly   199 DAWLYGAP----------TSTGTADFWPNGGYSLQPGCPKRNYKMLSDND----------LSSHR 243
            |    |||          ...|..||:||||..: |||.|.....:.|.|          ..:|.
Human   222 D----GAPIVPNLGFGMSQVVGHLDFFPNGGVEM-PGCKKNILSQIVDIDGIWEGTRDFAACNHL 281

  Fly   244 RSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVE----NCPPVVMGHHC------PTTIHGDF 298
            ||:.::.:|:.:  |.||...|...::.|..||...    .||.  |||:.      ...:...|
Human   282 RSYKYYTDSIVN--PDGFAGFPCASYNVFTANKCFPCPSGGCPQ--MGHYADRYPGKTNDVGQKF 342

  Fly   299 YLQTNGHTPFAR----------GKEGTVYVDPKDLLGN 326
            ||.|...:.|||          ||:.|.:: ...|.||
Human   343 YLDTGDASNFARWRYKVSVTLSGKKVTGHI-LVSLFGN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 93/323 (29%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 96/333 (29%)
PLAT_PL 355..465 CDD:238857 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.