DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG6277

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:314 Identity:90/314 - (28%)
Similarity:133/314 - (42%) Gaps:66/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LTT--AKFILY--YGPT-----VADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVESI 77
            |||  .||.||  ..||     .|.:...|.:.|.|         ...|...:||:.:.......
  Fly    63 LTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNS---------AHPTRFVIHGWTQSYTASMN 118

  Fly    78 HVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFD-HGLDIEKFHIVG 141
            ..|..|:|.|.|.|:||:||......:|...... :...|.::||::..:.| |||::...:::|
  Fly   119 KDIRSAWLSRGDYNVIVVDWARARSVDYATSVLA-VAATGKKVAKMINFLKDNHGLNLNDLYVIG 182

  Fly   142 HSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---YPGTHLSANDAEFVDVIHTDAWLY 203
            ||:|..:||..|    |.|.|  ::..|..||||.|||   .|...|:::||.:|:.|.|:....
  Fly   183 HSLGAHVAGYAG----KNTDG--QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTL 241

  Fly   204 GAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKK 268
            |.....|...|:|||| ..||||.      |......||.||..::||:||:      |.....|
  Fly   242 GFLKPIGKGAFYPNGG-KTQPGCG------LDLTGACSHGRSTTYYAEAVSE------DNFGTMK 293

  Fly   269 WSDFKQNKIVENCPPVVMGHHCPTT--------------IHGDFYLQTNGHTPF 308
            ..|:::          .:...|.:|              :.||:|:..|...||
  Fly   294 CGDYEE----------AVSKECGSTYSSVRMGADTNAYMVEGDYYVPVNSKAPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 86/306 (28%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 84/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.