DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG17191

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:309 Identity:88/309 - (28%)
Similarity:139/309 - (44%) Gaps:63/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FILY--YGPTV-----ADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHG----YLEDPDVESIHVI 80
            |.||  :.|||     ||:         |.:||.|.|..:.|...:||    |.:..:|:    |
  Fly    65 FYLYTKHNPTVGKEIRADA---------SSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVK----I 116

  Fly    81 AEAYLERKDTNLIVLDWGELADGNYMFD--AFPNLKQLGPELAKVLLKMFD-HGLDIEKFHIVGH 142
            ..|:|.:.|.|:||::|......:|:..  |.|.   .|.::.:::..:.: |.|.:|...::||
  Fly   117 TRAWLSKGDYNVIVVNWDRAQSVDYISSVRAVPG---AGAKVGEMIEYLHEHHHLSMESLEVIGH 178

  Fly   143 SMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---YPGTHLSANDAEFVDVIHTDAWLYG 204
            |:|..:||..|:::     |.:::..|..||||.|||   .|...||..||.:|:.|.|:....|
  Fly   179 SLGAHVAGYAGKQV-----GGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKG 238

  Fly   205 APTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLS---SHRRSWWFWAESVSDRYPIGFDAVPA 266
            .....|...|:||||.: ||||         .:|:.   :|.||..::.|:|::      |....
  Fly   239 FLKPIGKGTFYPNGGRN-QPGC---------GSDIGGTCAHGRSVTYYVEAVTE------DNFGT 287

  Fly   267 KKWSDFKQNKIVENCPPVVMGHHCPTT-----IHGDFYLQTNGHTPFAR 310
            .|..|: |..:...|.....|......     :.||||:..||..||.:
  Fly   288 IKCHDY-QAALANECGSTYSGVRMGAVTNAYMVDGDFYVPVNGQAPFGK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 84/300 (28%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 84/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.