DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG4582

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:302 Identity:87/302 - (28%)
Similarity:130/302 - (43%) Gaps:62/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVESIHVIAEAY--LERKDTNLIVLDWGEL 100
            |:..:|.|..||............:| :||:|.:.:....:.:..||  |...:.|:..:|||..
  Fly   143 SEPVNLYDAASLRRSRFSPFNPTRIL-IHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRG 206

  Fly   101 ADGNYMFDAFPNLKQLGPELAKVLLKMFDH---GLDIEKFHIVGHSMGGQLAGLLGREITKRTKG 162
            |..:|:..:: .:|.:|..|||.:  .|.|   |:..|...:||.|||..:|||.|:.:.     
  Fly   207 AIADYITASY-RVKPVGQVLAKFV--DFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQ----- 263

  Fly   163 VRKIKRISALDPAFPLF---YPGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQP 224
            ..:::.|.|||||.|.|   .|...|:|.||::|:|:||....||.....|..||:.|.| |.||
  Fly   264 TGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWG-SQQP 327

  Fly   225 GCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGF--DAVPAKKWSDFKQNKIVENCPPVVMG 287
            ||....         .||.|::..:|||::.....||  ...||.:|..            :...
  Fly   328 GCFWHE---------CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQ------------LTRF 371

  Fly   288 HHCP------TTIHGD---------------FYLQTNGHTPF 308
            |.||      .|:.||               :|.|||...|:
  Fly   372 HRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 84/295 (28%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 85/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.