DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and sxe2

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:301 Identity:87/301 - (28%)
Similarity:131/301 - (43%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYM 106
            |||    :|.:.|.:......:.:||:.......|...|.:|||.|.:.|:|:|||...:    :
  Fly    91 DLT----MLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQS----L 147

  Fly   107 FDAFPNLKQLGPELAKVLLKM--FDH---GLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKI 166
            ..::|.:.:..|.:|..:.||  |.|   |:..|:.:::|||.|..::||.|:.:.....|.   
  Fly   148 DISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGA--- 209

  Fly   167 KRISALDPAFPL---FYPGTHLSANDAEFVDVIHTDAWLYGAP-TSTGTADFWPNGGYSLQPGCP 227
              |.|||||...   ..|...|..|||.:|:.||||..|.|.| |....|.|:.|.|.. ||.||
  Fly   210 --IFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSHASFFANWGLG-QPHCP 271

  Fly   228 KRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFK--------------QNKIV 278
              |......:.:..|..:.:::||||  |.|..|.|:   :.|..|              :...|
  Fly   272 --NATATEFDFVCDHFAAMFYFAESV--RQPKSFAAL---RCSSAKSVLSATCNCNVGGSEKYAV 329

  Fly   279 ENCP-PVVMGHHCPTTIHGDFYLQTNGHTPFARGKEGTVYV 318
            ..|. ...||........|.|||.|...:|:.. .:|.|::
  Fly   330 NTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYGT-SDGLVHI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 83/284 (29%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 84/289 (29%)
Pancreat_lipase_like 72..356 CDD:238363 84/285 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.