DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG5665

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:379 Identity:95/379 - (25%)
Similarity:145/379 - (38%) Gaps:96/379 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLLCGLKNSKADLTTAKFILYYGPTVADSDIYD-------------------------------- 42
            |||..:...||::.||      .|....|:|.|                                
  Fly    37 RLLTDIATIKANILTA------APLELASNIIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQ 95

  Fly    43 -----LTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES-IHVIAEAYLERKDTNLIVLDWGELA 101
                 |.:...|.:......|:..|:...|:....:..| |.:|::|::.|.|.|.:::|..:..
  Fly    96 NYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYV 160

  Fly   102 DGNYMFDAFPNLKQLGPELAKVLLKMFD-------H---GLDIEKF--------HIVGHSMGGQL 148
            |..|.:.|. |...:|..:...|..:.:       |   |...|.|        ..||||:|..:
  Fly   161 DTFYAWSAL-NTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHI 224

  Fly   149 AGLLGREITKRTKGVRKIKRISALDPAFPLF-----YPGTHLSANDAEFVDVIHTDAWLYGAPTS 208
            .|..||...|.|.  :.|.||:.||||.|.|     .||  |:..||:.||:|||:..:......
  Fly   225 MGTAGRTFKKLTG--KLIPRITGLDPAKPCFRREKILPG--LTRGDAKLVDIIHTNIGILAKRGP 285

  Fly   209 TGTADFWPNGGYSLQPGCPKRNYKMLSDNDLS---SHRRSWWFWAESVSDRYPIGFDAVPAKKWS 270
            .|..||:|.|.:.:||||            |:   ||.|:..::|||........|.......|.
  Fly   286 LGDVDFYPGGAHPIQPGC------------LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWD 338

  Fly   271 DFKQNKIVENCPPVV---MGHHCPTTIHGDFYLQTNGHTPFARGKEGTVYVDPK 321
            :.::    .:|...:   ||:.......|.:|:..||..|:.|..|.|  |||:
  Fly   339 ELRK----RDCSAGIVSPMGYRMNPQARGIYYVDVNGWPPYGRNSENT--VDPR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 81/346 (23%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 75/305 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D310393at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.