DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and LIPC

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:282 Identity:81/282 - (28%)
Similarity:125/282 - (44%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VLYLHGYLEDPDVES-IHVIAEAYLER--KDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKV 123
            |:.:||:..|..:|: |..:..|...:  :..|:.::||..||..:|.. |..|.:.:|.|:| .
Human    96 VMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTI-AVRNTRLVGKEVA-A 158

  Fly   124 LLKMFDHGLDIEK--FHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---YPGT 183
            ||:..:..:.:.:  .|::|:|:|..::|..|..|    .|..||.||:.||.|.|||   .|..
Human   159 LLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSI----GGTHKIGRITGLDAAGPLFEGSAPSN 219

  Fly   184 HLSANDAEFVDVIHTDAWLY-----GAPTSTGTADFWPNGGYSLQPGC---------PKRNYKML 234
            .||.:||.|||.|||....:     |.....|..||:|||| |.||||         .:..:..:
Human   220 RLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGG-SFQPGCHFLELYRHIAQHGFNAI 283

  Fly   235 SDNDLSSHRRSWWFWAESV------SDRYPIGFDAVPAKKWSDFKQNKIVE----NCPPVVMGHH 289
            :.....||.||...:.:|:      |..||.|       ..:.|.|...:.    .|.  .:|:|
Human   284 TQTIKCSHERSVHLFIDSLLHAGTQSMAYPCG-------DMNSFSQGLCLSCKKGRCN--TLGYH 339

  Fly   290 C---PTTIHGDFYLQTNGHTPF 308
            .   |.:.....:|.|...:||
Human   340 VRQEPRSKSKRLFLVTRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 78/275 (28%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.