DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG10163

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:319 Identity:72/319 - (22%)
Similarity:137/319 - (42%) Gaps:59/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LYYGPTVADSDIYDLT--------DFQSLLEDEHLDLG--KNTVLYLHGYLEDPDVESIHVIAEA 83
            |:.|...:|:.::.:|        ..:|:.:.:..|:.  :.|::|         |.:.|. |::
  Fly    73 LFQGINPSDARLHVMTITNQSVELPIKSISQIKDFDINPERKTLIY---------VNAFHT-ADS 127

  Fly    84 YL-----------ERKDTNLIVLDWGELADGNYMFDAF-PNLKQLGPELAKVLLKMFDHGLDIEK 136
            |.           .|:|.|:||:|:.:  |...::.|. .:|...|..:.|:|..:.|.|:.::.
  Fly   128 YFSVQEHLTLLQNSRRDLNVIVVDFAK--DVAQLYYAVRHHLSVNGYFVYKLLRALKDAGIAVQD 190

  Fly   137 FHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGTHLSANDAEFVDVIHTDAW 201
            ..:.|||:|..:|.|..:...|..|  :.:.::.|:|||.........:..:.|..|.|:|.:..
  Fly   191 ITLAGHSVGANIAALGAQLFAKENK--QLVGQLLAIDPATMCRTTDILVKQSVALRVVVLHGEGD 253

  Fly   202 LYGAPTSTGTADFWPNG-GY----SLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGF 261
            ::|.....|..|.:||| ||    .|||||         ::.:.||...:..:.|::.:...|  
  Fly   254 VFGVRVPLGHIDIYPNGIGYFPRRKLQPGC---------ESKICSHMYPFILFMEALIEGVMI-- 307

  Fly   262 DAVPAKKWSDFKQNKIVENC---PPVVMGHHCPTTIHGDFYLQTNGHTPFARGKEGTVY 317
            .|...:.|:.|:|.    :|   ..:.:|...|....|.::..|..:.||...:.|..|
  Fly   308 PATKCESWAKFRQG----DCNFQNTINIGLIYPANAKGLYFCMTQPNPPFTYMEHGLRY 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 67/303 (22%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 64/286 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.