DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG13562

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:341 Identity:70/341 - (20%)
Similarity:114/341 - (33%) Gaps:94/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAIKNKSRLLCGLKNSKADLTTAKFILYYG------PTVADSDIYDLTDFQSLLEDEHLDLGKNT 61
            ||.:|.:  |...:..|.|......:::|.      .|.|..|.|||:.......|:.       
  Fly    40 KATQNDT--LAHQQRIKYDAQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKF------- 95

  Fly    62 VLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLK 126
            .:.|||:::....|....:.|.....:...:|.:|:..:|..:|| ..:.|...|...::.::|.
  Fly    96 AIVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDYSVVASSSYM-RLYTNFDTLTGAISSIILT 159

  Fly   127 MFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYP--------GT 183
            :|..|.|.::.::.|.|.|||||..:||.:...    ..|:.|...|.|.|.|.|        |.
  Fly   160 LFRQGFDPKRGYMFGFSFGGQLASAVGRSLRPH----HIIESIDTCDMAGPGFDPIAVDHSKAGK 220

  Fly   184 HL-----SANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSH- 242
            |:     |.:...||...|.:..|                     ..|..:...:.|...|.|| 
  Fly   221 HVQCFHSSRDKGTFVYSCHRNIML---------------------GSCGLKQPSVASQLHLGSHG 264

  Fly   243 ----------------------RRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVV 285
                                  ....|.....:.|.|.:|::                ||....|
  Fly   265 LCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIPDGYTVGYE----------------ENFDSQV 313

  Fly   286 MGH-HCPTTIHGDFYL 300
            .|. ..||::|..:.|
  Fly   314 TGQIFVPTSLHYPYNL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 64/321 (20%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.