DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG6472

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:319 Identity:110/319 - (34%)
Similarity:164/319 - (51%) Gaps:30/319 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGLKNSKADLTTAKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDP--DVE 75
            |.:| .:.|:   ||:||.......:.:..|:| .:.|...:.:......:||||:.|..  :.:
  Fly    36 CAIK-EREDI---KFMLYTSRNRNSAQLLHLSD-DARLAQSNFNFNYPLAIYLHGFSESATGERQ 95

  Fly    76 SIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDHGLDIEKFHIV 140
            |...:.:|:|.|.:.|:|::||..:....:..:|..||...|..||:.|..:.|.|...:..|::
  Fly    96 SSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLI 160

  Fly   141 GHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT---HLSANDAEFVDVIHTDAWL 202
            |.|:|.::||..|:::  :..|: |:.||:|||||.|||...:   .||.:||.||||||||..|
  Fly   161 GFSLGAEVAGFAGKQL--QEWGI-KLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGL 222

  Fly   203 YGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLS-----SHRRSWWFWAESVSDRYPIGFD 262
            .|.|...|.|||:||||..|||||.|:|   :::|.|.     ||:|:|.::.||::.  |.|| 
  Fly   223 LGNPAPMGHADFYPNGGRPLQPGCAKQN---IANNWLGIIVGCSHQRAWEYFVESIAQ--PRGF- 281

  Fly   263 AVPAKKWSDFKQNKIVENCP---PVVMGHHCPTTIHGDFYLQTNGHTPFARGKEGTVYV 318
              ||::........|... |   |..||......|.|.|||.||...||.|.......|
  Fly   282 --PAQRCEPSDMFGICRE-PGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRARAIV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 101/292 (35%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 103/295 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.