DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG7367

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:311 Identity:97/311 - (31%)
Similarity:144/311 - (46%) Gaps:49/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFILYYGPTVADSDIY-DLTDF-----------QSLLEDEHLDLGKNTVLYLHGYLEDPDVESIH 78
            ||.||...:.:.:|.: |..:|           |.:.|..:.:|  :|.:.:||:.......||.
  Fly    96 KFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPEL--DTKILVHGWKSSTMSNSIQ 158

  Fly    79 VIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVL-LKMFDHGLDIEKFHIVGH 142
            .|..||:||...|:..::|.:.||..|.........|:|..:||:: |.:.:...|..:.|::||
  Fly   159 SIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGH 223

  Fly   143 SMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY----PGTHLSANDAEFVDVIHTDAWLY 203
            |:|..:.|..| ..||     .::.||:.||||.|.|.    |..||...||.||||||:.|...
  Fly   224 SLGAHIMGYAG-SYTK-----YRVNRITGLDPARPAFEDCIGPENHLDDTDANFVDVIHSCAGYL 282

  Fly   204 GAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLS------SHRRSWWFWAESVSDRYPIGFD 262
            |.....|..||:||||...||||          .:||      ||.||:.::|||::.  |.||.
  Fly   283 GFRKPIGMVDFYPNGGGPPQPGC----------KELSQIFTGCSHGRSYEYYAESINS--PKGFY 335

  Fly   263 AVPAKKWSDFKQNKIVENCP--PVVMGHHCPTTIHGDFYLQTNGHTPFARG 311
            .||.....:.|.    :||.  .::||...|....|.|:::|.....:|.|
  Fly   336 GVPCSGLDELKG----KNCTGGKILMGDPVPREARGIFFVKTANKPSYALG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 94/301 (31%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 88/282 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.