DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG18641

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:314 Identity:92/314 - (29%)
Similarity:140/314 - (44%) Gaps:53/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGY------LEDPDVESIHVIAEAY 84
            :|.||...|....:..|:.| .:.|...|.:....|.:.:||:      ...||      :.|||
  Fly    71 QFYLYTRRTQEQPEFIDVLD-PNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPD------LREAY 128

  Fly    85 LERKDTNLIVLDWGELADGNYMFDAFPNLKQLG----------PELAKVLLKMFDHGLDIEKFHI 139
            ....:.|:|::|:.:....       |.|.|:.          .:|.|.|.: ...|:..:..|.
  Fly   129 FSVGEYNIIIVDYADAVKE-------PCLSQMDWAPRFGSLCISQLVKYLAR-HPRGVQPDDLHF 185

  Fly   140 VGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGTH----LSANDAEFVDVIHTDA 200
            :|:|:|..:|||:...: |..:|  |:.||:||||.. .||.|.:    |.:.||.||||:||.|
  Fly   186 IGYSVGAHIAGLVANYL-KPEEG--KLGRITALDPTI-FFYAGANNSRDLDSTDAHFVDVLHTGA 246

  Fly   201 WLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVP 265
            .:.|...|:|.|||:.||| :.||.|.  ....|.......|.:...::.||::...  ||.|.|
  Fly   247 GILGQWHSSGHADFYVNGG-TRQPACV--GSATLFQTLACDHTKVTPYFIESITTTR--GFYAGP 306

  Fly   266 AKKWSDFKQNKIVENCPP-----VVMGHHCPTTIHGDFYLQTNGHTPFARGKEG 314
            ......:    ::..|.|     |:||.||.....|::|:.||...|||||..|
  Fly   307 CPNLFSY----LIGWCEPKDSEYVLMGEHCSHKARGNYYVTTNAKAPFARGFPG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 84/301 (28%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 85/302 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.