DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG5162

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:356 Identity:103/356 - (28%)
Similarity:162/356 - (45%) Gaps:55/356 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKNKSRLLCGLKNSKADLTTAKFILYYGP----------TVADSDIYDLTDFQSLLEDEHLDLGK 59
            :.|...::|    |:| |.:.|....|.|          |..:...:.||..:|:.:....|:.|
  Fly    72 VSNSLNVIC----SQA-LASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKSPLFDVKK 131

  Fly    60 NTVLYLHGYLEDPD-VESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKV 123
            ..|:...|:....: .::|.|.::||..|.|.|.:.:|.....|..|.:.|| |.:::|..:|..
  Fly   132 KVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAF-NTEEIGENIALG 195

  Fly   124 LLKMFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGTHLSA- 187
            |:|:.|. :.:|..|::|||:|..:.|..||.:...|.  :.|.||:.||||.|.|..|..||. 
  Fly   196 LVKLLDL-VPVENIHLIGHSLGAHIVGSAGRHLQHLTN--QTIPRITGLDPAKPCFNEGEALSGL 257

  Fly   188 --NDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWA 250
              .||.||||||::..:.|.....|..||:|.|...|..||         .:...:|.|||.::|
  Fly   258 MRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC---------FSVTCAHARSWEYFA 313

  Fly   251 ESV---SDRYPIGFDAVPAKKWSDFKQNKIVENCP--PVVMGHHCPTTIHGDFYLQTNGHTPFAR 310
            |:|   ::|..:........|..||:       ||  .|.||:..|..|.|:::|:.:...||  
  Fly   314 ETVFPGNERNFMATRCNSISKLRDFR-------CPGDEVPMGYAVPQNIKGNYFLEVSASAPF-- 369

  Fly   311 GKEGTVYVDPKDLLGNTHSITCD-CPSEKTN 340
            |...:|       :.:.|...|. || |.|:
  Fly   370 GMHASV-------VRSAHLEHCGLCP-ESTS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 88/298 (30%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 86/294 (29%)
Pancreat_lipase_like 99..365 CDD:238363 85/285 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D310393at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.