DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG18258

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:324 Identity:103/324 - (31%)
Similarity:157/324 - (48%) Gaps:22/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLKNSK--ADLTTAKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES 76
            |:..||  .|::...|:|.......::.| .||..:.|.........:.|||::.|:....:..:
  Fly   159 GVVRSKLIPDMSRMSFLLRSSDDCQNTSI-PLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSN 222

  Fly    77 IHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDHGLDIEKFHIVG 141
            ...:|:|||.|.|||:::||.....|..|.:.|. |.:.:|..|||.||:: :.....::||:||
  Fly   223 SGPVAKAYLCRNDTNVLILDAANFIDTLYTWSAL-NTEVIGDYLAKALLRL-NTSYVTKQFHLVG 285

  Fly   142 HSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGTHLS---ANDAEFVDVIHTDAWLY 203
            ||:|.|:||..||.. :|..|.:.:|||:.||||.|.||.|..|.   :.||.|||:|||:..::
  Fly   286 HSLGAQIAGSAGRNY-RRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMF 349

  Fly   204 GAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIG---FDAVP 265
            |.....|.|||:..|....:|||..      .|....||:|:..:|.|:|   ||..   |.|..
  Fly   350 GTSKRAGDADFFVQGRIPFKPGCES------LDPISCSHQRAVDYWTETV---YPSNGNDFLAKR 405

  Fly   266 AKKWSDFKQNKIVENCPPVVMGHHCPTTIHGDFYLQTNGHTPFARGKEGTVYVDPKDLLGNTHS 329
            .|::|:.......:| ...|||:....|..|.||:..|...|:.:......|.:.....|:..|
  Fly   406 CKRYSELLLGNYCKN-TNTVMGYAAKATDLGLFYVGANPEEPYGQNANLQSYTNSDTKCGSCAS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 94/285 (33%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 94/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D310393at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.