DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Yp2

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:234 Identity:72/234 - (30%)
Similarity:115/234 - (49%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ERKDT---NLIVLDWGELADGNYMFDAFP--NLKQLGPELAKVLLKMFDH-GLDIEKFHIVGHSM 144
            |:.||   :|||:..|...:.   |:.:.  |:::||..:...|:::.:. .:..|..|::|...
  Fly   196 EQDDTKTGDLIVIQLGNAIED---FEQYATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGP 257

  Fly   145 GGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPG---THLSANDAEFVDVIHTDAWLYGAP 206
            ...:||:.||:.|::|.  .|::||:||||......|.   |.|:..||:|||.|||.|:..|..
  Fly   258 AAHVAGVAGRQFTRQTG--HKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTS 320

  Fly   207 TSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSD 271
            ......||:|||..:..||         :||.:.:..|:..::||||.......|.:|.|..:.:
  Fly   321 QRLANVDFFPNGPSTGVPG---------ADNVVEATMRATRYFAESVRPGNERNFPSVAASSYQE 376

  Fly   272 FKQNKIVENCPPVVMGHHCPTTIHGDFYLQTNGHTPFAR 310
            :||||....  ...||......:.||:.||.|..:||.|
  Fly   377 YKQNKGYGK--RGYMGIATDFDLQGDYILQVNSKSPFGR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 68/225 (30%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 69/230 (30%)
Abhydrolase <221..407 CDD:304388 60/198 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.