DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and CG5966

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:365 Identity:101/365 - (27%)
Similarity:156/365 - (42%) Gaps:79/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KADLTTAKFILYYG--------PTVA---------DSDI---YDLTDFQSLLEDEHLDL------ 57
            |:|:...|....||        .||.         .|:|   :.|...::|.:.::|||      
  Fly    38 KSDINEVKCFGVYGCFPINGPWNTVTRSINVHPQKPSEIEPHFTLHTRRALDQPKYLDLNDPESV 102

  Fly    58 ---GKN----TVLYLHGYLEDPDVESIHVIAEAYLERKD---TNLIVLDWGELADGNYMFDAFPN 112
               |.|    ..|.:|||||..::..:..:|:|.|..:.   .:::::|||..|...|: .|..|
  Fly   103 QGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEPEGRASVVLIDWGGGASPPYV-QAVAN 166

  Fly   113 LKQLGPELAKVLLKMFDHGL--DIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPA 175
            ::.:|...|.|:..:::...  :::..||:|||:|..|:|..|..: :...|: |..||:.||||
  Fly   167 IRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYAGYHL-QHDFGL-KPARITGLDPA 229

  Fly   176 FPLFY---PGTHLSANDAEFVDVIHTDA-----WLYGAPTSTGTADFWPNGGYSLQPGCPKRNYK 232
            .|||.   |...|...||.|||::||||     ...|.....|..||:||||:. .|||.|:...
  Fly   230 APLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFD-NPGCNKKFQD 293

  Fly   233 MLSDNDL---------SSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPP----V 284
            ::....|         .:|.||..::.||:..:.|  |..:....:..||..|......|    :
  Fly   294 VVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCP--FLGITCDSFESFKDTKCTSCEEPGHTCL 356

  Fly   285 VMGHHCPTTIH--------------GDFYLQTNGHTPFAR 310
            .||:|......              |.|||.|....||.|
  Fly   357 RMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPFCR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 95/352 (27%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 95/353 (27%)
Pancreat_lipase_like 76..390 CDD:238363 90/319 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.