DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Lipg

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:289 Identity:81/289 - (28%)
Similarity:127/289 - (43%) Gaps:46/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLEDEHLDLGKNTVLYLHGYLEDPDVES-IHVIAEAYLER-KDTNLIVLDWGELADGNYMFDAFP 111
            |||:...::...|...:||:......|| :|.:..|...| |:.|::|:||..||...|: ||..
  Rat    75 LLENCGFNMTAKTFFIIHGWTMSGMFESWLHKLVSALQTREKEANVVVVDWLPLAHQLYI-DAVS 138

  Fly   112 NLKQLGPELAKVLLKMFDHG-LDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPA 175
            |.:.:|..:|.:|..:.:.| ..:...|::|:|:|..:||..|..:    ||.  :.||:.||||
  Rat   139 NTRVVGRRVAGMLNWLQEKGEFSLGDVHLIGYSLGAHVAGYAGNFV----KGT--VGRITGLDPA 197

  Fly   176 FPLFYP---GTHLSANDAEFVDVIHTDAWLYGAPTS----TGTADFWPNGGYSLQPGCPKRN--- 230
            .|:|..   ...||.:||:||||:||....:|....    .|..|.:|||| ..||||...:   
  Rat   198 GPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGG-DFQPGCGFNDVMG 261

  Fly   231 ---YKMLSDNDLSSHRRSWWFWAESV--SDRYPIGFDAVPAKKWSDFKQ-----------NKIVE 279
               |..:|:.....|.|:...:.:|:  .|:....|......:   ||:           |.|..
  Rat   262 SFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQCTDPNR---FKRGICLSCRKNRCNNIGY 323

  Fly   280 NCPPVVMGHHCPTTIHGDFYLQTNGHTPF 308
            |...:....      :...||:|....||
  Rat   324 NAKKMRKKR------NSKMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 78/282 (28%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 79/283 (28%)
lipo_lipase 53..488 CDD:132274 81/289 (28%)
Heparin-binding. /evidence=ECO:0000250 327..339 1/17 (6%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.