DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Pnlip

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:351 Identity:103/351 - (29%)
Similarity:164/351 - (46%) Gaps:52/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLLCGLKNSKADLTTAKFILYYGPTVADSDIYD-LTDFQSLLEDEHLDLGKNTVLYLHGYLEDPD 73
            |.|..|..|.|.:.| :|:||   |..:.|.|. :|...|.:.:.:....:.|.:.:||:::..:
  Rat    39 RPLKALPWSPAQINT-RFLLY---TNENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGE 99

  Fly    74 VESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKV--LLKMFDHGLDIEK 136
            ...:..:.:...:.:..|.|.:||...:...|. .|..|::.:|.|:|.:  :||. |.|...:.
  Rat   100 ENWLSDMCKNMFKVESVNCICVDWKGGSRATYT-QATQNVRVVGAEVALLVNVLKS-DLGYSPDN 162

  Fly   137 FHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT----HLSANDAEFVDVIH 197
            .|::|||:|..:||    |..|||.|.  |.||:.||.|.| ::.||    .|...||:|||.||
  Rat   163 VHLIGHSLGSHVAG----EAGKRTFGA--IGRITGLDAAEP-YFQGTPEEVRLDPTDAQFVDAIH 220

  Fly   198 TDA------WLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDND----------LSSHRRSW 246
            |||      ..:|...:.|..||:||||..: |||.|.....:.|.|          ..:|.||:
  Rat   221 TDAAPIIPNLGFGMSQTVGHLDFFPNGGMEM-PGCQKNILSQIVDIDGIWEGTRDFAACNHLRSY 284

  Fly   247 WFWAESVSDRYPIGFDAVPAKKWSDFKQNKIV----ENCPPVVMGHHC------PTTIHGDFYLQ 301
            .::.:|:.:  |.||.......::.|..||..    |.||.  |||:.      ...::..|||.
  Rat   285 KYYTDSIVN--PTGFSGFSCSSYNVFSANKCFPCGSEGCPQ--MGHYADKYPGKTKELYQKFYLN 345

  Fly   302 TNGHTPFARGK-EGTVYVDPKDLLGN 326
            |...:.|||.: :.||.:..:.:.|:
  Rat   346 TGDKSNFARWRYQVTVTLSGQKVTGH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 91/312 (29%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 97/330 (29%)
PLAT_PL 355..465 CDD:238857 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.