DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Liph

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001077363.1 Gene:Liph / 239759 MGIID:2388029 Length:451 Species:Mus musculus


Alignment Length:248 Identity:72/248 - (29%)
Similarity:116/248 - (46%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LDLGKNTVLYLHGY--LEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLG 117
            |::.|.|...:||:  ...|.| .|..:.::.:..::.|::|:||...|.......|....:|:.
Mouse    65 LNVTKKTTFIIHGFRPTGSPPV-WIEELVQSLISVQEMNVVVVDWNRGATTVIYPHASSKTRQVA 128

  Fly   118 PELAKVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY-- 180
            ..|.:.:.:|...|..::..:::|.|:|..:||.:|...    :|  |:.|::.||||.|||.  
Mouse   129 SILKEFIDQMLVKGASLDNIYMIGVSLGAHIAGFVGESY----EG--KLGRVTGLDPAGPLFNGR 187

  Fly   181 -PGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPK------RNYKMLSDND 238
             |...|..:||.||||||:|....|...:.|..||:||||.. ||||||      :.:|      
Mouse   188 PPEERLDPSDALFVDVIHSDTDALGYKEALGHIDFYPNGGLD-QPGCPKTIFGGIKYFK------ 245

  Fly   239 LSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVE-------NCPPV 284
             ..|:.|.:.:..|:.:...|  .|.|...:.|::..|.|.       .||.|
Mouse   246 -CDHQMSVYLYLASLQNNCSI--TAYPCDSYRDYRNGKCVSCGAGQIVPCPRV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 72/248 (29%)
LiphNP_001077363.1 Pancreat_lipase_like 41..310 CDD:238363 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.