DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:357 Identity:108/357 - (30%)
Similarity:160/357 - (44%) Gaps:73/357 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LCGLKNSKADLTTAKFILYYGPTVADSDIYDLTDF--QSLLEDEHLDLGKNTVLYLHGYLEDPDV 74
            |.||..|...:.| :|:||   |:.:.:.|.....  .|.::..:....|.|.:.:.|:..|...
Human    42 LVGLPWSPEKINT-RFLLY---TIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKW 102

  Fly    75 ESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELA---KVLLKMFDHGLDIEK 136
            :  ..:....|:.:|.|.|.|||  :........|..||:.:|.|:|   .||:|.|::  ...|
Human   103 Q--RDMCNVLLQLEDINCINLDW--INGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEY--SPSK 161

  Fly   137 FHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY---PGTHLSANDAEFVDVIHT 198
            .|::|||:|..|||..|..|.       .:.||:.||||.|.|:   ....|..:||.|||||||
Human   162 VHLIGHSLGAHLAGEAGSRIP-------GLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHT 219

  Fly   199 DA--WLY----GAPTSTGTADFWPNGGYSLQPGCP-------KRNY-----KMLSDNDLSSHRRS 245
            :|  .|:    |...:.|..||:||||..: |||.       |.|:     :|.|..| .:|.||
Human   220 NAARILFELGVGTIDACGHLDFYPNGGKHM-PGCEDLITPLLKFNFNAYKKEMASFFD-CNHARS 282

  Fly   246 WWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIV----ENCPPVVMGHHCP-------TTIHGDFY 299
            :.|:|||:.:  |..|.|.|.:.::.||.....    |.||  .|||...       .|....::
Human   283 YQFYAESILN--PDAFIAYPCRSYTSFKAGNCFFCSKEGCP--TMGHFADRFHFKNMKTNGSHYF 343

  Fly   300 LQTNGHTPFARGK-------------EGTVYV 318
            |.|...:||||.:             :|||::
Human   344 LNTGSLSPFARWRHKLSVKLSGSEVTQGTVFL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 96/316 (30%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 101/332 (30%)
Pancreat_lipase_like 52..348 CDD:238363 97/318 (31%)
PLAT_PL 355..467 CDD:238857 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.