DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:331 Identity:94/331 - (28%)
Similarity:144/331 - (43%) Gaps:60/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKADLTTAKFILYYGP--------TVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDV 74
            |..|:.| :|:||...        :..:.|....::||         |.:.|...:||:::..:.
  Rat    61 SPEDIDT-RFLLYTNENPNNYQKISATEPDTIKFSNFQ---------LDRKTRFIVHGFIDKGED 115

  Fly    75 ESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELA-KVLLKMFDHGLDIEKFH 138
            ..:..:.:...:.:..|.|.:||...:...|. .|..|.:.:|.|:| .|.:...:.|...|..|
  Rat   116 GWLLDMCKKMFQVEKVNCICVDWRRGSRTEYT-QASYNTRVVGAEIAFLVQVLSTEMGYSPENVH 179

  Fly   139 IVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY---PGTHLSANDAEFVDVIHTDA 200
            ::|||:|..:.|..||    |.:|  .:.||:.||||.|.|.   ....|..:||.||||||||:
  Rat   180 LIGHSLGAHVVGEAGR----RLEG--HVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDS 238

  Fly   201 -----WL-YGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSD-NDL---------SSHRRSWWFW 249
                 :| :|.....|..||:||||..: |||.|.....:.| |.:         .:|.||:.::
  Rat   239 APIIPYLGFGMSQKVGHLDFFPNGGKEM-PGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYY 302

  Fly   250 AESVSDRYPIGFDAVPAKKWSDFKQNKIV----ENCPPVVMGHHC------PTTIHGDFYLQTNG 304
            |.|:.:  |.||...|...:..|:||...    |.||.  |||:.      ..|:....||.|..
  Rat   303 ASSILN--PDGFLGYPCSSYEKFQQNDCFPCPEEGCPK--MGHYADQFEGKTATVEQTVYLNTGD 363

  Fly   305 HTPFAR 310
            ...|.|
  Rat   364 SGNFTR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 89/317 (28%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 92/327 (28%)
Pancreat_lipase_like 65..363 CDD:238363 90/319 (28%)
PLAT_PL 370..482 CDD:238857 94/331 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.