DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and LOC101884800

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:380 Identity:99/380 - (26%)
Similarity:159/380 - (41%) Gaps:90/380 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKADLTTAKFILYYGPTVADSDI-YDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES-IHVI 80
            ||..:.:.:|        .|.|: |.:...|..:.|.:......|.|.:||:......|| ::.:
Zfish    41 SKFSIRSVEF--------PDEDLCYLVPGQQDSISDCNFKNDSQTFLIIHGWSVAGLFESWVYKL 97

  Fly    81 AEAYLERK-DTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVL--LKMFDHGLDIEKFHIVGH 142
            ..|..:|: ..|:||:||.:.|:.:|...| .|.:.:|.::||.:  |:..|:.|  ||.|::|:
Zfish    98 VTALYDREPSANVIVVDWLDRANKHYPKSA-ENTRLVGADVAKFVNWLEELDYPL--EKVHLLGY 159

  Fly   143 SMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPG---THLSANDAEFVDVIHTDAWLYG 204
            |:|..:||:.| .:|.     .|:.||:.||||.|.|...   ..||.:||.||||:||:.  .|
Zfish   160 SLGAHVAGVAG-NLTN-----NKVHRITGLDPAGPSFENADILRRLSPDDASFVDVLHTNT--RG 216

  Fly   205 AP-------TSTGTADFWPNGGYSLQPGCP-KRNYKMLSDNDL--------SSHRRSWWFWAES- 252
            :|       ...|..|.:|||| :.||||. :...|:::...:        .||.||...:.:| 
Zfish   217 SPDLSIGIQRPVGHVDIYPNGG-TFQPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSL 280

  Fly   253 VSDRYPIGFDAVPAKKWS------DFKQNKIVENCPPVVMGHHCPT----------TIHGDFYLQ 301
            |:..|         :.|:      |.....:..:|    ..:.|.|          |.....||:
Zfish   281 VNQAY---------QSWAFRCASRDSFNKGLCLSC----RKNRCNTLGYNVKKIRSTRSTKMYLK 332

  Fly   302 TNGHTPFA-----------RGKEGTVYVDPKDL-----LGNTHSITCDCPSEKTN 340
            |....||.           ..|..|:...|..:     :...:.|:...||..||
Zfish   333 TREMMPFKVFHYQIKMHMFSDKNMTLLEQPMKVSLFGTIDERNDISVIVPSMSTN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 86/320 (27%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 99/380 (26%)
Pancreat_lipase_like 39..335 CDD:238363 89/326 (27%)
PLAT 342..464 CDD:294016 8/46 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.