DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:260 Identity:82/260 - (31%)
Similarity:122/260 - (46%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFILYYGPTVADSDI-YDLTDFQSLLEDEHLDLGKNTVLYLHGY----LEDPDVESIHVIAEAYL 85
            ||.| ..|:..|.|: |.:......|...:.:....|:|.:||:    |.:..||.:  :|..|.
Zfish    54 KFSL-RNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKL--VAALYN 115

  Fly    86 ERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDH--GLDIEKFHIVGHSMGGQL 148
            ..||.|:||:||.:.|..:|:. |..|.|.:|.|:. :.:...:.  .:.:|..|::|:|:|..:
Zfish   116 REKDANVIVVDWLDTAQDHYVV-AAQNTKMVGREIG-LFIDWIEETSNVPLENLHLIGYSLGAHV 178

  Fly   149 AGLLGREITKRTKGVRKIKRISALDPAFPLFYPGTH----LSANDAEFVDVIHTD-----AWLYG 204
            ||..|...|      .||.||:.||||.|.| .|.|    ||.:||.||||:||.     ....|
Zfish   179 AGFAGSHTT------NKIGRITGLDPAGPDF-EGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIG 236

  Fly   205 APTSTGTADFWPNGGYSLQPGCPKR-------NYKMLSDNDL--SSHRRSWWFWAESVSDRYPIG 260
            .....|..|.:|||| |.||||..|       :|.:.:.|:.  ..|.||...:.:|:.:....|
Zfish   237 IEQPVGHVDIYPNGG-SFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAG 300

  Fly   261  260
            Zfish   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 82/260 (32%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 82/260 (32%)
Pancreat_lipase_like 51..347 CDD:238363 82/260 (32%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.