DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and lipib

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:364 Identity:92/364 - (25%)
Similarity:156/364 - (42%) Gaps:79/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLCGLKNSKADLTT--------------AKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNT 61
            |||..:::..|..|              .:.:||   |.|:.:........:..:....::.:.|
Zfish    14 LLCKGEDNDCDNFTDLDFHESFIGTNLYVRLLLY---TRANLECGQELPHHNFTQQPLFNVTRPT 75

  Fly    62 VLYLHGYLED--PDV---ESIHVIAEAYLERKDTNLIVLDWGE-LADGNYMFDAFPNLKQLGPEL 120
            ...:|||...  |.:   ..:|::|    .:||.|::|:||.. .|:.||: .|..|.:.....:
Zfish    76 TFVIHGYRPTGAPPIWINHIVHLLA----AQKDMNILVVDWNRGAANLNYL-TAVANTRGTALNI 135

  Fly   121 AKVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---YPG 182
            .:.:..|...|..::..|::|.|:|..:||.:|..:..|      :.||:.||||.|:|   .|.
Zfish   136 TRFIESMEKEGASLDSIHLIGVSLGAHVAGFIGAMLGGR------VGRITGLDPAGPMFASVSPE 194

  Fly   183 THLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWW 247
            ..|...||:||||:|||...:|...:.|..||:.|||.. ||||||..:...| ..:..|:||.:
Zfish   195 ERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYANGGLD-QPGCPKTIFSGKS-YFVCDHQRSVF 257

  Fly   248 FWAESVSDRYPI-GFDAVPAKKWSDFKQNKIVE-------NCPPVVMGHHCPTTIHGDFYLQTNG 304
            .:..|::....: |:   |...:|||...:.::       :||  |:|:                
Zfish   258 LYLCSLNRTCSLTGY---PCSSYSDFLSGQCLQCETFKPASCP--VLGY---------------- 301

  Fly   305 HTPFARGKEGTVYVDPKDLLGNTH---SITCDCPSEKTN 340
                    :.:.:.|....||.|.   |.|.:.|..||:
Zfish   302 --------DLSQWRDTLLRLGQTRAYFSTTAELPYSKTS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 79/310 (25%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 84/335 (25%)
Pancreat_lipase_like 40..324 CDD:238363 83/328 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.