powered by:
Protein Alignment RpS13 and MRPS28
DIOPT Version :9
Sequence 1: | NP_001033885.1 |
Gene: | RpS13 / 34149 |
FlyBaseID: | FBgn0010265 |
Length: | 151 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010624.3 |
Gene: | MRPS28 / 851937 |
SGDID: | S000002745 |
Length: | 286 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 31 |
Identity: | 12/31 - (38%) |
Similarity: | 17/31 - (54%) |
Gaps: | 2/31 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 HLERNRKDKDGKFRL-ILVESRIHRLARYYK 130
|::.:|||......| |||:.| ..:.||.|
Yeast 191 HIKEHRKDFANTRNLRILVQQR-QAILRYLK 220
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0184 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.