DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS13 and RPS13

DIOPT Version :9

Sequence 1:NP_001033885.1 Gene:RpS13 / 34149 FlyBaseID:FBgn0010265 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010349.3 Gene:RPS13 / 851636 SGDID:S000002471 Length:151 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:108/150 - (72%)
Similarity:131/150 - (87%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRF 65
            |||||:.|||||.||:||.|..|:|.||:::.|.|||.|..:||||||:||::|||:|||.|.|.
Yeast     1 MGRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIGVLLRDAHGVTQARV 65

  Fly    66 VNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKHLERNRKDKDGKFRLILVESRIHRLARYYK 130
            :.||||:||:||.||.|:||||||::|||||::||||||||||||.||||||:|||||||||||:
Yeast    66 ITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYR 130

  Fly   131 TKSVLPPNWKYESSTASALV 150
            |.:||||||||||:||||||
Yeast   131 TVAVLPPNWKYESATASALV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS13NP_001033885.1 PTZ00072 4..151 CDD:185427 104/146 (71%)
Ribosomal_S13_N 4..60 CDD:285331 33/55 (60%)
Ribosomal_S15p_S13e 70..145 CDD:238213 60/74 (81%)
RPS13NP_010349.3 PTZ00072 4..151 CDD:185427 104/146 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345451
Domainoid 1 1.000 129 1.000 Domainoid score I1153
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128182
Inparanoid 1 1.050 233 1.000 Inparanoid score I720
Isobase 1 0.950 - 0 Normalized mean entropy S33
OMA 1 1.010 - - QHG62177
OrthoFinder 1 1.000 - - FOG0003596
OrthoInspector 1 1.000 - - oto99166
orthoMCL 1 0.900 - - OOG6_100971
Panther 1 1.100 - - LDO PTHR11885
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1231
SonicParanoid 1 1.000 - - X2468
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.