DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS13 and RPS13A

DIOPT Version :9

Sequence 1:NP_001033885.1 Gene:RpS13 / 34149 FlyBaseID:FBgn0010265 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_567151.1 Gene:RPS13A / 828167 AraportID:AT4G00100 Length:151 Species:Arabidopsis thaliana


Alignment Length:151 Identity:114/151 - (75%)
Similarity:128/151 - (84%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRF 65
            |||||:.|||||.|||||:|:.|||||..:.||.|.|.|..|||||||:||:|||||||:.||:.
plant     1 MGRMHSRGKGISASALPYKRSSPSWLKTTSQDVDESICKFAKKGLTPSQIGVILRDSHGIPQVKS 65

  Fly    66 VNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKHLERNRKDKDGKFRLILVESRIHRLARYYK 130
            |.|:|||||:|:.||.|:|||||||:|||||||||||||||||||.|||||||||||||||||||
plant    66 VTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYK 130

  Fly   131 TKSVLPPNWKYESSTASALVA 151
            ....|||.|||||:|||.|||
plant   131 KTKKLPPVWKYESTTASTLVA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS13NP_001033885.1 PTZ00072 4..151 CDD:185427 109/146 (75%)
Ribosomal_S13_N 4..60 CDD:285331 38/55 (69%)
Ribosomal_S15p_S13e 70..145 CDD:238213 62/74 (84%)
RPS13ANP_567151.1 PTZ00072 4..151 CDD:185427 109/146 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1814
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128182
Inparanoid 1 1.050 232 1.000 Inparanoid score I1132
OMA 1 1.010 - - QHG62177
OrthoDB 1 1.010 - - D1387147at2759
OrthoFinder 1 1.000 - - FOG0003596
OrthoInspector 1 1.000 - - otm3342
orthoMCL 1 0.900 - - OOG6_100971
Panther 1 1.100 - - O PTHR11885
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2468
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.