DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpS13 and MRPS15

DIOPT Version :9

Sequence 1:	NP_001033885.1	Gene:	RpS13 / 34149	FlyBaseID:	FBgn0010265	Length:	151	Species:	Drosophila melanogaster
Sequence 2:	NP_112570.2	Gene:	MRPS15 / 64960	HGNCID:	14504	Length:	257	Species:	Homo sapiens

Alignment Length:	138	Identity:	31/138 - (22%)
Similarity:	56/138 - (40%)	Gaps:	39/138 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 PGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRFV----- 66
            |...:.|:|..|....|:..:|:.|.             .||   .:|:|...|..:..|
Human    42 PRSLLLQAARGYVVRKPAQSRLDDDP-------------PPS---TLLKDYQNVPGIEKVDDVVK 90

  Fly    67 --------NGNKILRIMKSVGLKPDI--PEDLYHMIKKAVAI-------RKHLERNRKDKDGK-F 113
                    |..::|:|.:...:|..:  |||...:..:.:|:       .:|||::||||..| :
Human    91 RLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRY 155

  Fly   114 RLILVESR 121
            .|:.::.|
Human   156 LLMSIDQR 163

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpS13	NP_001033885.1	PTZ00072	4..151	CDD:185427	31/138 (22%)
		Ribosomal_S13_N	4..60	CDD:285331	11/52 (21%)
		Ribosomal_S15p_S13e	70..145	CDD:238213	17/62 (27%)
MRPS15	NP_112570.2	Ribosomal_S15	112..187	CDD:395247	15/52 (29%)
MRPS15	NP_112570.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	225..257
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0184
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900