DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS13 and rps13

DIOPT Version :9

Sequence 1:NP_001033885.1 Gene:RpS13 / 34149 FlyBaseID:FBgn0010265 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001016602.1 Gene:rps13 / 549356 XenbaseID:XB-GENE-940105 Length:151 Species:Xenopus tropicalis


Alignment Length:151 Identity:131/151 - (86%)
Similarity:143/151 - (94%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRF 65
            ||||||||||:|||||||||:||:||||.:|||||||.||.|||||||:||:|||||||||||||
 Frog     1 MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRF 65

  Fly    66 VNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKHLERNRKDKDGKFRLILVESRIHRLARYYK 130
            |.|||||||:||.||.||:||||||:||||||:||||||||||||.||||||:||||||||||||
 Frog    66 VTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYK 130

  Fly   131 TKSVLPPNWKYESSTASALVA 151
            |:.||||||||||||||||||
 Frog   131 TRRVLPPNWKYESSTASALVA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS13NP_001033885.1 PTZ00072 4..151 CDD:185427 126/146 (86%)
Ribosomal_S13_N 4..60 CDD:285331 46/55 (84%)
Ribosomal_S15p_S13e 70..145 CDD:238213 64/74 (86%)
rps13NP_001016602.1 PTZ00072 4..151 CDD:185427 126/146 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4956
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128182
Inparanoid 1 1.050 228 1.000 Inparanoid score I3390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1387147at2759
OrthoFinder 1 1.000 - - FOG0003596
OrthoInspector 1 1.000 - - oto102711
Panther 1 1.100 - - LDO PTHR11885
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2468
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.