DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS13 and mrps-15

DIOPT Version :9

Sequence 1:NP_001033885.1 Gene:RpS13 / 34149 FlyBaseID:FBgn0010265 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_492351.1 Gene:mrps-15 / 187087 WormBaseID:WBGene00010624 Length:330 Species:Caenorhabditis elegans


Alignment Length:162 Identity:27/162 - (16%)
Similarity:64/162 - (39%) Gaps:40/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SWL-------KLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQV-RFVNGNKILRIMKSVGL 80
            :||       .|..:|:.::.||  |......:|.:::.:.....:: |..|.....:.:.::.:
 Worm   153 AWLTALIRHWSLLVNDIGQETKK--KPTWLTHRIWLVINERRKALRILRERNETAFEKTIAALKI 215

  Fly    81 KPDIPEDLYHM-IKKAVA-----IR-----------------KHLERNRKDKDGKFRLILVESRI 122
            ...:|:...|: .:||.|     :|                 |.:|.::::...|.:.:  .:.:
 Worm   216 SYHVPKQPAHVKTRKAWAEAQLKLRVENEKEKRLEELHEKYDKEVEEHKRETQEKRKAL--NNEL 278

  Fly   123 HRLARYYKTKSVLPPN-----WKYESSTASAL 149
            .:||:..:...|:...     .|||.:..|:|
 Worm   279 DKLAQEMRQIDVIEGKSFETVGKYEPALISSL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS13NP_001033885.1 PTZ00072 4..151 CDD:185427 27/162 (17%)
Ribosomal_S13_N 4..60 CDD:285331 8/42 (19%)
Ribosomal_S15p_S13e 70..145 CDD:238213 15/102 (15%)
mrps-15NP_492351.1 FAM184 <235..287 CDD:292293 6/53 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.