DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS13 and Rps13

DIOPT Version :9

Sequence 1:NP_001033885.1 Gene:RpS13 / 34149 FlyBaseID:FBgn0010265 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_569116.1 Gene:Rps13 / 161477 RGDID:621027 Length:151 Species:Rattus norvegicus


Alignment Length:151 Identity:132/151 - (87%)
Similarity:143/151 - (94%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRF 65
            ||||||||||:|||||||||:||:||||.:|||||||.||.|||||||:||:|||||||||||||
  Rat     1 MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRF 65

  Fly    66 VNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKHLERNRKDKDGKFRLILVESRIHRLARYYK 130
            |.|||||||:||.||.||:||||||:||||||:||||||||||||.||||||:||||||||||||
  Rat    66 VTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYK 130

  Fly   131 TKSVLPPNWKYESSTASALVA 151
            ||.||||||||||||||||||
  Rat   131 TKRVLPPNWKYESSTASALVA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS13NP_001033885.1 PTZ00072 4..151 CDD:185427 127/146 (87%)
Ribosomal_S13_N 4..60 CDD:285331 46/55 (84%)
Ribosomal_S15p_S13e 70..145 CDD:238213 65/74 (88%)
Rps13NP_569116.1 PTZ00072 4..151 CDD:185427 127/146 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4794
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I2897
OMA 1 1.010 - - QHG62177
OrthoDB 1 1.010 - - D1387147at2759
OrthoFinder 1 1.000 - - FOG0003596
OrthoInspector 1 1.000 - - otm44743
orthoMCL 1 0.900 - - OOG6_100971
Panther 1 1.100 - - LDO PTHR11885
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2468
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.