DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7627 and YKR104W

DIOPT Version :9

Sequence 1:NP_001245943.1 Gene:CG7627 / 34148 FlyBaseID:FBgn0032026 Length:1355 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:135/317 - (42%)
Similarity:201/317 - (63%) Gaps:33/317 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1055 MTAVERVVEYEDI--EPEGALEAPADKKPPKSWPEQGKIVFDELSLRYTPDPKSENVLKSLSFVI 1117
            |::|||:.||.||  |..|.:      .||.:||:.|.:....|||||:  |.|...|.::||.:
Yeast     1 MSSVERIKEYTDIPSESNGYI------SPPANWPQTGDVELKNLSLRYS--PHSSKALDNVSFKV 57

  Fly  1118 KPKEKVGIVGRTGAGKSSLINALFRLS-YNDGSVLIDKRDTSEMGLHDLRSKISIIPQEPVLFSG 1181
            |...||||||||||||||:|.|::||| :.:|::.||.:|...:.|..||:.||.|||:|.||.|
Yeast    58 KAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDG 122

  Fly  1182 TMRYNLDPFDEYSDDKLWRSLEEVKLKEVVADL--------PS-----------GLQSKITEGGT 1227
            |:|.||||||.|||.:::..|.:|.|.|...:|        |:           .|.:.:..||:
Yeast   123 TVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGS 187

  Fly  1228 NFSVGQRQLVCLARAILRENRILVMDEATANVDPQTDGLIQTTIRNKFKECTVLTIAHRLHTIMD 1292
            |.|.|||||:||||::|....|:::|||||::|..:|..||.|||...|..|:|||||||.:::|
Yeast   188 NLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVID 252

  Fly  1293 SDKVLVMDAGRAVEFGTPYELLTLADSKVFHGMVKQTGHATYESLLKIAQKAFENRQ 1349
            .||:|||:.||..|:..||.|::..:: :|:.:.:|:|.  :|:|.::|:.:|:|::
Yeast   253 YDKILVMEMGRVKEYDHPYTLISDRNT-IFYRLCRQSGE--FENLFELAKVSFDNKR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7627NP_001245943.1 CFTR_protein 12..1315 CDD:273530 127/281 (45%)
ABC_membrane 107..360 CDD:294371
ABCC_MRP_domain1 445..645 CDD:213217
ABC_membrane 815..1014 CDD:294371
ABCC_MRP_domain2 1089..1310 CDD:213211 110/240 (46%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 112/244 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.