DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14274 and twit

DIOPT Version :9

Sequence 1:NP_609212.2 Gene:CG14274 / 34145 FlyBaseID:FBgn0032023 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster


Alignment Length:104 Identity:33/104 - (31%)
Similarity:44/104 - (42%) Gaps:37/104 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CQKVVAKDPDTRKVVTARFCQLDTGDSDACEILRTKLRIPSPEEREQRNRNQNKRRKGHGQDAEE 144
            |:|.|  :.:..|::|.|||.. |..||..|:    ..|.|||        :|.||         
  Fly    88 CRKTV--EENNGKLITKRFCYY-TNKSDPVEL----CNITSPE--------KNVRR--------- 128

  Fly   145 DDEISAEDAFFCGICKSHRCNGAAAVTLSLATILAMIAL 183
                     .||..|.:.|||||    |:.|:||.|:.|
  Fly   129 ---------IFCEDCLTDRCNGA----LAGASILEMLLL 154



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147170at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.