DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment witty and CG6583

DIOPT Version :10

Sequence 1:NP_609212.2 Gene:witty / 34145 FlyBaseID:FBgn0032023 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_609556.2 Gene:CG6583 / 34645 FlyBaseID:FBgn0032420 Length:154 Species:Drosophila melanogaster


Alignment Length:199 Identity:39/199 - (19%)
Similarity:68/199 - (34%) Gaps:51/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 LDLYSGKPVRVLQAVKGLIGAPQNNFKILKNGKVV--YDDKREKSMFNRILREMFPRDGRTKDER 273
            ||.|:.|.|:||     ::|.|.|.     |..|.  |.....|:.|..:.|....|.......|
  Fly   117 LDKYAKKDVKVL-----VVGNPANT-----NALVCSHYAPSIPKANFTAMTRLDQNRAQAQIAGR 171

  Fly   274 STIFMNLIKEILLKDFTTNDEHCDRKLLSIKKDRKKKDKNQLHERACNPVNQQFLPQSCALRQIL 338
            ..:.:..:|.:::....:..:..|.:..|::.|...|.                :|::.|..:.|
  Fly   172 LGVGITKVKNVIIWGNHSATQVPDARNASVEVDGATKT----------------VPEAVADDEFL 220

  Fly   339 DVQLL---VKSSISTIDPSKLNKSRSDPYSYIDEMYEKYLTYQEDALYDGRGSSRTTWPNGSFCA 400
            ..|.|   .|...:.|...|::.:.|...:..|.|.:                    |..|:...
  Fly   221 KQQFLETVQKRGAAVIAARKMSSAMSAAKAASDHMRD--------------------WFAGTRDG 265

  Fly   401 EYLS 404
            ||:|
  Fly   266 EYVS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wittyNP_609212.2 TFP 18..>51 CDD:480272
CG6583NP_609556.2 QVR 22..125 CDD:435716 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.