DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14275 and bero

DIOPT Version :10

Sequence 1:NP_609211.1 Gene:CG14275 / 34144 FlyBaseID:FBgn0032022 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_610069.2 Gene:bero / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:54/138 - (39%) Gaps:31/138 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAITTYVYAMCLVLAANLLTVNAIRCHQCNSHDNEDCGGLVVNTPRAQRDNQYLTDC-------- 57
            :|:...:...|        :..||:|:||.|.....||      .:.:.|...|.||        
  Fly     9 LAVAVMISLAC--------SAYAIKCYQCESLTMPKCG------LKFEADETLLLDCSRIGPPRY 59

  Fly    58 ----VPPSGEVAFCRKTVINFEQNDERRIERSCGFIP-EKIQNACFTADNEGY-KQIIC-TCPDE 115
                .|........:||:.:...:.:  |.|||.|.. ..||..|.:..:..: ||:.| .|..:
  Fly    60 LQNFFPLRNATGCMKKTLESVAGHPQ--IVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCTKD 122

  Fly   116 GCNGASSL 123
            .|||:|||
  Fly   123 ECNGSSSL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14275NP_609211.1 QVR 24..118 CDD:435716 26/108 (24%)
beroNP_610069.2 TFP 23..127 CDD:480272 29/111 (26%)

Return to query results.
Submit another query.