DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14275 and CG7781

DIOPT Version :9

Sequence 1:NP_609211.1 Gene:CG14275 / 34144 FlyBaseID:FBgn0032022 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001285745.1 Gene:CG7781 / 34143 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster


Alignment Length:150 Identity:46/150 - (30%)
Similarity:74/150 - (49%) Gaps:22/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YVYAM-CLVLAANLLTVNAIRCHQCNSHDNEDCGGLVVNTPRAQRDNQYLTDCVPP-----SGEV 64
            |:|.: .|:||..:....||:|..||||.:.:|   .::.|   .|| .|.||...     .|..
  Fly     3 YIYVISALILAIAVQQGYAIKCFVCNSHKDANC---ALDIP---PDN-LLKDCDEQYSSRGKGIP 60

  Fly    65 AFCRK--TVINFEQND---ERRIERSCGFIPEKIQNACFTADNEGYKQIICTCPDEGCNGASSLL 124
            .:|||  .:|.|..|.   :.|:.|:|.:..:...|.|:.....|.:|::|:|..:.||||.: :
  Fly    61 TYCRKITQIIEFSVNSLPPDSRVIRTCAYQNQTSTNYCYQRAGFGGRQVVCSCDTDNCNGAGA-M 124

  Fly   125 GVRQLGYSLVGSVVSLALAS 144
            |...||   |.::|.|.|::
  Fly   125 GASALG---VAAMVGLLLSA 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DEAA
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27522
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.