DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14275 and rtv

DIOPT Version :10

Sequence 1:NP_609211.1 Gene:CG14275 / 34144 FlyBaseID:FBgn0032022 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_572693.1 Gene:rtv / 32056 FlyBaseID:FBgn0261277 Length:151 Species:Drosophila melanogaster


Alignment Length:167 Identity:34/167 - (20%)
Similarity:55/167 - (32%) Gaps:73/167 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAITTYVYAMCLVLAANLLTVNAI--RCHQCNSHDNEDCGGLVVNTPRAQRDNQYLTDCVPPSGE 63
            |..|:.:.|:..::  :|::::.:  ||:||.|.                             ||
  Fly     1 MQFTSLLLAVIFLI--SLVSIDGLLRRCYQCRSR-----------------------------GE 34

  Fly    64 VAFCRKTVINFEQNDERRIERS------------CGFIPE------------KIQNACFTA---D 101
            :..| |....|...|   :|:.            ||.:.|            .||..|...   |
  Fly    35 LGSC-KDPFTFNATD---VEQEPGVAAIPCASGWCGKVIEGGGTYAIDDYDLAIQRMCVQRGPDD 95

  Fly   102 N--------EGYKQI-ICTCPDEGCNGASSLLGVRQL 129
            |        ..||:: :|.|..:.||||.|.....|:
  Fly    96 NMDRCADTIYNYKKVYMCFCQGDLCNGARSWSSAPQM 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14275NP_609211.1 QVR 24..118 CDD:435716 24/131 (18%)
rtvNP_572693.1 TFP_LU_ECD_Rtv 23..123 CDD:467118 26/132 (20%)

Return to query results.
Submit another query.