DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7781 and crim

DIOPT Version :9

Sequence 1:NP_001285745.1 Gene:CG7781 / 34143 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_648500.1 Gene:crim / 39321 FlyBaseID:FBgn0036198 Length:158 Species:Drosophila melanogaster


Alignment Length:163 Identity:39/163 - (23%)
Similarity:59/163 - (36%) Gaps:50/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VISALILAIAVQQGYAIKCFVCNSHKDANCALDIPPDNLLKDCDEQYSSRGKGI--------PTY 62
            :|:||:||..:.:|.||.|:.|.|              ....|.|:::.||.|.        ...
  Fly     7 LIAALLLAALIHEGSAIWCYRCTS--------------ATPGCAEKFNWRGIGFLGEHCPEPDDI 57

  Fly    63 CRKITQ--------------IIEFSVNSLPPDSRVIRTCAYQNQTSTNYCYQ-------RAGFGG 106
            |.|:|:              .:.|. ..:|.|.......|..::...||...       |..:..
  Fly    58 CVKVTERRGARETITRDCLSALSFR-KDIPADKYEGCRPAAHDEKLANYVNHTIKEHDVRRDYYT 121

  Fly   107 RQVVCSCDTDN-CNGAGAMGASALGVAAMVGLL 138
            ....|.|..|: ||     |||.|..:|::|||
  Fly   122 DTTFCFCFLDHRCN-----GASGLQTSAVIGLL 149



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.