DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7781 and CG9338

DIOPT Version :9

Sequence 1:NP_001285745.1 Gene:CG7781 / 34143 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001260646.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster


Alignment Length:142 Identity:39/142 - (27%)
Similarity:63/142 - (44%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VISALILAIAVQQGYAIKCFVCNSHKDANCALDIPPD-NLLKDCDEQYSSR--GKGIP----TYC 63
            :::..:||.....||||||:.|:|..::.|..||..| :|:.||.:....|  ....|    |.|
  Fly     8 ILALTVLATVACTGYAIKCYQCDSLTNSECGKDIKSDSSLVLDCTKMAPPRFLQNFFPVRNATGC 72

  Fly    64 RKITQIIEFSVNSLPPDSRVIRTCAYQNQTSTNY-CYQRAGFG-GRQVVCS-CDTDNCNGAGAMG 125
            .|  |.|:     :|.:.:::|:|.:.|...|.. |....... .:.:.|. |..|.|||..::.
  Fly    73 MK--QTID-----IPGNPQIVRSCYFGNIADTKVGCQTDPSLTINKLLSCEVCTEDECNGTSSLA 130

  Fly   126 ASALGVAAMVGL 137
            ..|..:....||
  Fly   131 PIAGVILLFFGL 142



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.