Sequence 1: | NP_001285745.1 | Gene: | CG7781 / 34143 | FlyBaseID: | FBgn0032021 | Length: | 147 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260646.1 | Gene: | CG9338 / 35357 | FlyBaseID: | FBgn0032899 | Length: | 147 | Species: | Drosophila melanogaster |
Alignment Length: | 142 | Identity: | 39/142 - (27%) |
---|---|---|---|
Similarity: | 63/142 - (44%) | Gaps: | 17/142 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VISALILAIAVQQGYAIKCFVCNSHKDANCALDIPPD-NLLKDCDEQYSSR--GKGIP----TYC 63
Fly 64 RKITQIIEFSVNSLPPDSRVIRTCAYQNQTSTNY-CYQRAGFG-GRQVVCS-CDTDNCNGAGAMG 125
Fly 126 ASALGVAAMVGL 137 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR33562 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |