DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7781 and ddn-2

DIOPT Version :9

Sequence 1:NP_001285745.1 Gene:CG7781 / 34143 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_496748.2 Gene:ddn-2 / 185266 WormBaseID:WBGene00009399 Length:161 Species:Caenorhabditis elegans


Alignment Length:138 Identity:36/138 - (26%)
Similarity:58/138 - (42%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILAIAVQQGYAIKCFVCNS-------HKDANCALDIPPDNLLKDCDEQYSSRGKGIPTYCRKIT 67
            :|||......|||||..|..       .|:|...|:|..|:|..||.:...|......|:|.|..
 Worm     9 IILAFITSSAYAIKCHQCGGAEKIPKFAKNALAKLNISVDSLYGDCKKTSGSDMCSNGTFCLKRA 73

  Fly    68 QIIEFSVNSLPPD-SRVIRTCAY----QNQTSTNYCYQ------RAGFGGRQVVCSCDTDNCNGA 121
            ::.:...:.:... :...:.||.    .:|..||.||:      .:|:..:::.|.|..|.||..
 Worm    74 KVYQIGYSGVNLKWTTYTKGCATLREDNDQIPTNTCYELGQVSNSSGYTAKRMDCYCQKDFCNST 138

  Fly   122 GAMGASAL 129
            ..:|.|.:
 Worm   139 TNLGGSLI 146



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I7928
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4119
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.