DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7781 and K11H12.7

DIOPT Version :9

Sequence 1:NP_001285745.1 Gene:CG7781 / 34143 FlyBaseID:FBgn0032021 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_499966.1 Gene:K11H12.7 / 176893 WormBaseID:WBGene00019663 Length:127 Species:Caenorhabditis elegans


Alignment Length:125 Identity:29/125 - (23%)
Similarity:51/125 - (40%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYIYVISALILAIAVQQGYAIKCFVCNSHKDANCALDIPPDNLLKDCDEQYSSRGKGI-PTYCR 64
            |:::.|.::|....|     |:.|::|||.....|..:....|  |.|..:.....|.: |..||
 Worm     1 MRFLIVFASLFAVSA-----ALNCYICNSLNQPECVHNYEKFN--KICPVKSFGGMKSVKPLGCR 58

  Fly    65 KITQIIEFSVNSLPPDSRVIRTCAYQN---QTSTNYCYQRAGFGGRQVVCSCDTDNCNGA 121
            ...|.::       .::.::|.|||..   :..:|    :...|..:|...|..:.||.|
 Worm    59 VSRQYVK-------EETSIVRECAYTGEDIERKSN----KGSLGVSRVYSQCSENLCNSA 107



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.