DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and DSS4

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_015342.1 Gene:DSS4 / 856128 SGDID:S000006221 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:28/119 - (23%)
Similarity:49/119 - (41%) Gaps:42/119 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SNVRCQF--CNCLMLKAQEGTYNQEE-VDVPLMTQK-----QDRT-ADSLNSEPLKDFWLVKDMM 73
            |...|.|  |:..::     |.|.:. :::|.....     ::|| .|:..||  .:|.:|.|:.
Yeast     2 SKATCSFEGCHSAVI-----TINDDNIINLPEQVHSEFKLLENRTMRDATPSE--SNFLVVPDVW 59

  Fly    74 TFENIGFSNTVDGR--------------------------KFLVCADCERGPVG 101
            .|:|:|.|..:...                          |:|:||||::||:|
Yeast    60 DFDNVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 24/101 (24%)
DSS4NP_015342.1 RabGEF 2..136 CDD:238150 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - LDO PTHR13276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.