DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and RABIF

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_002862.2 Gene:RABIF / 5877 HGNCID:9797 Length:123 Species:Homo sapiens


Alignment Length:117 Identity:46/117 - (39%)
Similarity:75/117 - (64%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SEQIT-DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLN--SEPLKDFWLV 69
            ||.:: :|:|:..|.||.|...:|:.....:::.::.:|.| :|:...:|..|  .:.|::.|||
Human     8 SELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSM-RKKPALSDGSNPDGDLLQEHWLV 71

  Fly    70 KDMMTFENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            :||..|||:||:..|...|||||||||.||:|:|.|..::. |:||:||.|:
Human    72 EDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 36/87 (41%)
RABIFNP_002862.2 RabGEF 19..123 CDD:238150 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152303
Domainoid 1 1.000 73 1.000 Domainoid score I9283
eggNOG 1 0.900 - - E1_KOG4113
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37702
Inparanoid 1 1.050 87 1.000 Inparanoid score I5151
Isobase 1 0.950 - 0 Normalized mean entropy S4823
OMA 1 1.010 - - QHG49075
OrthoDB 1 1.010 - - D1495679at2759
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 1 1.000 - - oto90045
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - LDO PTHR13276
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R754
SonicParanoid 1 1.000 - - X4040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.