DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and rabif

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001002511.1 Gene:rabif / 436784 ZFINID:ZDB-GENE-040718-216 Length:132 Species:Danio rerio


Alignment Length:111 Identity:45/111 - (40%)
Similarity:66/111 - (59%) Gaps:3/111 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQD--RTADSLNSEPLKDFWLVKDMMTF 75
            ||||...|.||.|...:|......:.::|:.:|.|.:|..  ::..:|:.:.|...|||.||.||
Zfish    22 DGKNVKAVLCQRCGSKVLCPGMAVFAEKELFLPSMRKKTSIGQSDGTLDGDTLMAHWLVDDMYTF 86

  Fly    76 ENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            ||:||:..|...|:|:|||||.||:|:|.|..:.. |:||.||.|:
Zfish    87 ENVGFTKDVGKVKYLICADCEIGPIGWHCLDDKKSFYVALDRVNHE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 35/87 (40%)
rabifNP_001002511.1 Mss4 43..131 CDD:282300 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586795
Domainoid 1 1.000 71 1.000 Domainoid score I9446
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37702
Inparanoid 1 1.050 84 1.000 Inparanoid score I5152
OMA 1 1.010 - - QHG49075
OrthoDB 1 1.010 - - D1495679at2759
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 1 1.000 - - oto41260
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - LDO PTHR13276
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R754
SonicParanoid 1 1.000 - - X4040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.