DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and mdt-9

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001255737.1 Gene:mdt-9 / 36805063 WormBaseID:WBGene00014938 Length:147 Species:Caenorhabditis elegans


Alignment Length:103 Identity:41/103 - (39%)
Similarity:65/103 - (63%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NKSNVRCQFC-NCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLNSEPLKDFWLVKDMMTFENIG 79
            |:|...|:.| ..::||.....|..||.|:||..||  :..|...:||::.|:.||||..|||:|
 Worm    32 NESTYICKICQTVVILKNMTTEYLDEERDLPLPRQK--KGIDHTQTEPIRGFFGVKDMFAFENVG 94

  Fly    80 FSNTVDGRKFLVCADCERGPVGYHDLSTRHCYLALKRV 117
            |:.:.:|:::|||.:||:||||:.|..|...|::.:|:
 Worm    95 FTRSSEGKRYLVCGECEQGPVGFVDPVTEMNYVSPERL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 35/84 (42%)
mdt-9NP_001255737.1 Mss4 51..134 CDD:282300 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162444
Domainoid 1 1.000 75 1.000 Domainoid score I5915
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3866
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 1 1.000 - - oto20240
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - LDO PTHR13276
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R754
SonicParanoid 1 1.000 - - X4040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.