DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and ZK970.8

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001367069.1 Gene:ZK970.8 / 3565809 WormBaseID:WBGene00014174 Length:143 Species:Caenorhabditis elegans


Alignment Length:109 Identity:29/109 - (26%)
Similarity:55/109 - (50%) Gaps:5/109 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGKNKSNVRCQFCNCLMLKAQ-EGTYNQEEVDVPLMTQKQDRTADSLNSEPLKDFWLVKDMMTFE 76
            |.:|...|.|:.|..::.... ..|...:...:.:||.   :....|..|.:..:|..::.|.|:
 Worm    37 DDRNLHKVVCRRCKSVIFPEDVVMTVENQPYQLRVMTH---QAKGPLAQEKISWWWYTENDMIFD 98

  Fly    77 NIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHCYLALKRVVHK 120
            .:|: .|||.:|.|:|.|||.||:|:.....:..::|::||.::
 Worm    99 TVGW-QTVDKKKVLMCGDCELGPIGFRSEDNKKFWVAVERVKYE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 24/84 (29%)
ZK970.8NP_001367069.1 RabGEF 50..140 CDD:412202 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4823
OMA 1 1.010 - - QHG49075
OrthoDB 1 1.010 - - D1495679at2759
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - O PTHR13276
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R754
SonicParanoid 1 1.000 - - X4040
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.770

Return to query results.
Submit another query.