DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and Rabif

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001007679.1 Gene:Rabif / 304807 RGDID:1359331 Length:123 Species:Rattus norvegicus


Alignment Length:111 Identity:45/111 - (40%)
Similarity:69/111 - (62%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLN--SEPLKDFWLVKDMMTF 75
            :|:|:..|.||.|...:|:.....:::.::.:|.|.:|.| ..|..|  .:.|::.|||.||..|
  Rat    14 EGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPD-LVDGSNPDGDVLEEHWLVNDMFIF 77

  Fly    76 ENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120
            ||:||:..|...|||||||||.||:|:|.|..::. |:||:||.|:
  Rat    78 ENVGFTKDVGNVKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 37/87 (43%)
RabifNP_001007679.1 RabGEF 19..123 CDD:238150 42/104 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345801
Domainoid 1 1.000 75 1.000 Domainoid score I8872
eggNOG 1 0.900 - - E1_KOG4113
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37702
Inparanoid 1 1.050 89 1.000 Inparanoid score I5044
OMA 1 1.010 - - QHG49075
OrthoDB 1 1.010 - - D1495679at2759
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 1 1.000 - - oto97161
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - LDO PTHR13276
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4040
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.