DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and SPBC4C3.04c

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_596302.1 Gene:SPBC4C3.04c / 2540823 PomBaseID:SPBC4C3.04c Length:100 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:37/104 - (35%)
Similarity:56/104 - (53%) Gaps:18/104 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SNVR--CQFCNCLMLKAQEGTYNQEEVDV---PLMT-QKQDRTADSLNSEPLKDFWLVKDMMTFE 76
            ||:|  ||.|..::       :|.:..||   |.|: .....|.:.|.::   ||:|:||...|:
pombe     2 SNLRIVCQHCPSVV-------FNNKRPDVVKRPTMSAMLHSETQEDLETD---DFFLLKDPFAFD 56

  Fly    77 NIGFSNTV-DGRKFLVCADCERGPVGYHDLSTRHCYLAL 114
            |:..|..: :..|.|.|||||:||:||:| |..:.||.|
pombe    57 NVSVSKPLANNYKLLACADCEKGPLGYYD-SKNNEYLLL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 31/86 (36%)
SPBC4C3.04cNP_596302.1 RabGEF 4..100 CDD:238150 35/102 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3450
eggNOG 1 0.900 - - E1_KOG4113
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2050
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 1 1.000 - - oto101284
orthoMCL 1 0.900 - - OOG6_106143
Panther 1 1.100 - - LDO PTHR13276
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R754
SonicParanoid 1 1.000 - - X4040
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.